PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0021ss01890.1
Common NameLR48_Vigan05g182200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family LBD
Protein Properties Length: 196aa    MW: 21503.3 Da    PI: 5.1998
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0021ss01890.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260133.11.1e-41331321100
             DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 
                        +CaaCk+lrr+Ca++Cvlapyfp ++p+kf ++h++FGasn++k+l++lpe +r da++s+vyeA ar+rdPvyG++g i +lq+q+++l+a
  Vang0021ss01890.1  33 PCAACKILRRRCAEKCVLAPYFPPTEPAKFTIAHRVFGASNIIKFLQELPEGQRADAVASMVYEAGARIRDPVYGSAGAICQLQKQVNELQA 124
                        7******************************************************************************************* PP

             DUF260  93 elallkee 100
                        +la++++e
  Vang0021ss01890.1 125 QLAKAQAE 132
                        ****9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.43532133IPR004883Lateral organ boundaries, LOB
PfamPF031958.6E-4233130IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005739Cellular Componentmitochondrion
Sequence ? help Back to Top
Protein Sequence    Length: 196 aa     Download sequence    Send to blast
MESDANTLSS SPTFSHSSNT LSSSSPPQVV MTPCAACKIL RRRCAEKCVL APYFPPTEPA  60
KFTIAHRVFG ASNIIKFLQE LPEGQRADAV ASMVYEAGAR IRDPVYGSAG AICQLQKQVN  120
ELQAQLAKAQ AEVVNMQFQQ ANLVALICME MSQTPQESPQ QSLDNFITSP SHYQNNLSFF  180
EDNTNLNSLW EPLWT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150400.0AP015040.1 Vigna angularis var. angularis DNA, chromosome 7, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014497455.11e-129PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR01e-79LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A0L9UNR11e-144A0A0L9UNR1_PHAAN; Uncharacterized protein
TrEMBLA0A0S3SGG91e-144A0A0S3SGG9_PHAAN; Uncharacterized protein
STRINGGLYMA13G40370.21e-118(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.11e-72LOB domain-containing protein 1
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]